Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Twitchin [49174] (2 species) |
Species Human (Homo sapiens), Ig repeat 27 [TaxId:9606] [49176] (2 PDB entries) |
Domain d1tiua_: 1tiu A: [21715] |
PDB Entry: 1tiu (more details)
SCOPe Domain Sequences for d1tiua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} lievekplygvevfvgetahfeielsepdvhgqwklkgqpltaspdceiiedgkkhilil hncqlgmtgevsfqaanaksaanlkvkel
Timeline for d1tiua_: