SCOPe 2.08: Domain d3u0wl2: 3u0w L:108-213

Lineage for d3u0wl2 (3u0w L:108-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d3u0wl2: 3u0w L:108-213 [217138]
   Other proteins in same PDB: d3u0wh_, d3u0wl1
   automated match to d1rhha2

Details for d3u0wl2

PDB Entry: 3u0w, 2 Å

PDB Description: ad related murine antibody fragment

PDB Compounds: (L:) Fab Light Chain, Ig kappa chain C region

SCOPe Domain Sequences for d3u0wl2:

Sequence; same for both SEQRES and ATOM records:

>d3u0wl2 b.1.1.2 (L:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d3u0wl2:

• d3u0wl2 first appeared in SCOPe 2.03
  
• d3u0wl2 appears in SCOPe 2.07