![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.4: I set domains [49159] (39 proteins) |
![]() | Protein Twitchin [49174] (2 species) |
![]() | Species Nematode (Caenorhabditis elegans) [TaxId:6239] [49175] (3 PDB entries) different modules |
![]() | Domain d1wiua_: 1wiu A: [21713] |
PDB Entry: 1wiu (more details)
SCOPe Domain Sequences for d1wiua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} lkpkiltasrkikikagfthnlevdfigapdptatwtvgdsgaalapellvdakssttsi ffpsakradsgnyklkvknelgedeaifevivq
Timeline for d1wiua_: