SCOPe 2.07: Domain d3u0fa2: 3u0f A:250-407

Lineage for d3u0fa2 (3u0f A:250-407)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (81 species)
   not a true protein

7. Species Brucella melitensis [TaxId:359391] [225909] (5 PDB entries)

8. Domain d3u0fa2: 3u0f A:250-407 [217128]
   automated match to d1e5ma2
   complexed with 07l, cl, moh, na

Details for d3u0fa2

PDB Entry: 3u0f, 1.25 Å

PDB Description: the structure of beta-ketoacyl synthase from brucella melitensis bound to the fragment 7-hydroxycoumarin

PDB Compounds: (A:) Beta-ketoacyl synthase

SCOPe Domain Sequences for d3u0fa2:

Sequence; same for both SEQRES and ATOM records:

>d3u0fa2 c.95.1.0 (A:250-407) automated matches {Brucella melitensis [TaxId: 359391]}
kiygeivgygatsdgydmvapsgegaircmkmalstvtskidyinphatstpagdapeie
airqifgagdvcppiaatksltghslgatgvqeaiysllmmqnnficesahieeldpafa
dmpivrkridnvqlntvlsnsfgfggtnatlvfqryqg

Timeline for d3u0fa2:

• d3u0fa2 first appeared in SCOPe 2.03
  
• d3u0fa2 appears in SCOPe 2.06
  
• d3u0fa2 appears in the current release, SCOPe 2.08