Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (52 species) not a true protein |
Species Brucella melitensis [TaxId:359391] [225909] (4 PDB entries) |
Domain d3u0ea2: 3u0e A:250-407 [217126] automated match to d1e5ma2 complexed with 07k, cl, na |
PDB Entry: 3u0e (more details), 1.6 Å
SCOPe Domain Sequences for d3u0ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u0ea2 c.95.1.0 (A:250-407) automated matches {Brucella melitensis [TaxId: 359391]} kiygeivgygatsdgydmvapsgegaircmkmalstvtskidyinphatstpagdapeie airqifgagdvcppiaatksltghslgatgvqeaiysllmmqnnficesahieeldpafa dmpivrkridnvqlntvlsnsfgfggtnatlvfqryqg
Timeline for d3u0ea2: