SCOPe 2.06: Domain d3u0dd_: 3u0d D:

Lineage for d3u0dd_ (3u0d D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50836] (39 PDB entries)

8. Domain d3u0dd_: 3u0d D: [217124]
   automated match to d4iawa_
   complexed with cl, dbh, fe

Details for d3u0dd_

PDB Entry: 3u0d, 2.51 Å

PDB Description: the structure of human siderocalin bound to the bacterial siderophore 2,3-dhba

PDB Compounds: (D:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d3u0dd_:

Sequence; same for both SEQRES and ATOM records:

>d3u0dd_ b.60.1.1 (D:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
sdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedksy
nvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffk
kvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg

Timeline for d3u0dd_:

• d3u0dd_ first appeared in SCOPe 2.03
  
• d3u0dd_ appears in SCOPe 2.05
  
• d3u0dd_ appears in SCOPe 2.07
  
• d3u0dd_ appears in the current release, SCOPe 2.08