SCOPe 2.04: Domain d1koaa1: 1koa A:6265-6361

Lineage for d1koaa1 (1koa A:6265-6361)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Twitchin [49174] (2 species)

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [49175] (3 PDB entries)
   different modules

8. Domain d1koaa1: 1koa A:6265-6361 [21712]
   Other proteins in same PDB: d1koaa2

Details for d1koaa1

PDB Entry: 1koa, 3.3 Å

PDB Description: twitchin kinase fragment (c.elegans), autoregulated protein kinase and immunoglobulin domains

PDB Compounds: (A:) twitchin

SCOPe Domain Sequences for d1koaa1:

Sequence; same for both SEQRES and ATOM records:

>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
qprfivkpygtevgegqsanfycrviassppvvtwhkddrelkqsvkymkryngndyglt
inrvkgddkgeytvraknsygtkeeivflnvtrhsep

Timeline for d1koaa1:

• d1koaa1 first appeared (with stable ids) in SCOP 1.55, called d1koa_1
  
• d1koaa1 appears in SCOPe 2.03
  
• d1koaa1 appears in SCOPe 2.05
  
• d1koaa1 appears in the current release, SCOPe 2.08