SCOPe 2.03: Domain d3u03a_: 3u03 A:

Lineage for d3u03a_ (3u03 A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50836] (28 PDB entries)

8. Domain d3u03a_: 3u03 A: [217119]
   automated match to d4iawa_
   complexed with 488, fe

Details for d3u03a_

PDB Entry: 3u03, 2.4 Å

PDB Description: the structure of human siderocalin bound to the bacterial siderophore pyochelin

PDB Compounds: (A:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d3u03a_:

Sequence; same for both SEQRES and ATOM records:

>d3u03a_ b.60.1.1 (A:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
sdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedksy
nvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffk
kvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg

Timeline for d3u03a_:

• d3u03a_ is new in SCOPe 2.03-stable
  
• d3u03a_ appears in SCOPe 2.04
  
• d3u03a_ last appears in SCOPe 2.07