Lineage for d3tzna1 (3tzn A:1-275)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089689Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 2089690Family c.1.21.1: Dihydropteroate synthetase [51718] (2 protein domains)
  6. 2089772Protein automated matches [194480] (6 species)
    not a true protein
  7. 2089779Species Yersinia pestis [TaxId:632] [195817] (4 PDB entries)
  8. 2089784Domain d3tzna1: 3tzn A:1-275 [217117]
    Other proteins in same PDB: d3tzna2
    automated match to d3tzfb_

Details for d3tzna1

PDB Entry: 3tzn (more details), 2.08 Å

PDB Description: Crystal Structure of the Yersinia pestis Dihydropteroate synthase.
PDB Compounds: (A:) 7,8-dihydropteroate synthase

SCOPe Domain Sequences for d3tzna1:

Sequence, based on SEQRES records: (download)

>d3tzna1 c.1.21.1 (A:1-275) automated matches {Yersinia pestis [TaxId: 632]}
mhltargltldlsrpqvmgilnvtpdsfsdggchnnldqalqhaqrmlsagatlidigge
strpgaaevseqeeldrvvpvvealaqrfdvwlsvdtskaavitesahagahlindirsl
qepgaleaaaktglpvclmhmqgqpknmqhspyyddlmtdinrffqhhiercvaagiakn
kllldpgfgfgknlahnyqllahlselhhfelpllvgmsrksmvgqllnvppqqrvigsv
acaviaamqgaqiirvhdvketveamciveatrsa

Sequence, based on observed residues (ATOM records): (download)

>d3tzna1 c.1.21.1 (A:1-275) automated matches {Yersinia pestis [TaxId: 632]}
mhltargltldlsrpqvmgilnnldqalqhaqrmlsagatlidiggeldrvvpvvealaq
rfdvwlsvdtskaavitesahagahlindirslqepgaleaaaktglpvclmhmqhspyy
ddlmtdinrffqhhiercvaagiaknkllldpgfgfgknlahnyqllahlselhhfelpl
lvgmsrksmvgqllnvppqqrvigsvacaviaamqgaqiirvhdvketveamciveatrs
a

SCOPe Domain Coordinates for d3tzna1:

Click to download the PDB-style file with coordinates for d3tzna1.
(The format of our PDB-style files is described here.)

Timeline for d3tzna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tzna2
View in 3D
Domains from other chains:
(mouse over for more information)
d3tznb_