SCOPe 2.08: Domain d3tzda1: 3tzd A:29-81

Lineage for d3tzda1 (3tzd A:29-81)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.2: Chromo domain [54165] (8 proteins)
   lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold

6. Protein automated matches [191035] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188859] (14 PDB entries)

8. Domain d3tzda1: 3tzd A:29-81 [217114]
   Other proteins in same PDB: d3tzda2
   automated match to d4haea_
   protein/DNA complex

Details for d3tzda1

PDB Entry: 3tzd, 1.81 Å

PDB Description: Crystal structure of the complex of Human Chromobox Homolog 3 (CBX3)

PDB Compounds: (A:) Chromobox protein homolog 3

SCOPe Domain Sequences for d3tzda1:

Sequence; same for both SEQRES and ATOM records:

>d3tzda1 b.34.13.2 (A:29-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efvvekvldrrvvngkveyflkwkgftdadntwepeenldcpelieaflnsqk

Timeline for d3tzda1:

• d3tzda1 first appeared in SCOPe 2.03, called d3tzda_
  
• d3tzda1 appears in SCOPe 2.07