![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.4: I set domains [49159] (39 proteins) |
![]() | Protein Titin [49172] (1 species) |
![]() | Species Human (Homo sapiens), different modules [TaxId:9606] [49173] (8 PDB entries) |
![]() | Domain d1tnna_: 1tnn A: [21711] module M5 |
PDB Entry: 1tnn (more details)
SCOPe Domain Sequences for d1tnna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} riltkprsmtvyegesarfscdtdgepvptvtwlrkgqvlstsarhqvtttkykstfeis svqasdegnysvvvensegkqeaeftltiqk
Timeline for d1tnna_: