SCOPe 2.08: Domain d1tnna_: 1tnn A:

Lineage for d1tnna_ (1tnn A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Titin [49172] (1 species)

7. Species Human (Homo sapiens), different modules [TaxId:9606] [49173] (8 PDB entries)

8. Domain d1tnna_: 1tnn A: [21711]
   module M5

Details for d1tnna_

PDB Entry: 1tnn

PDB Description: tertiary structure of an immunoglobulin-like domain from the giant muscle protein titin: a new member of the i set

PDB Compounds: (A:) titin module m5

SCOPe Domain Sequences for d1tnna_:

Sequence; same for both SEQRES and ATOM records:

>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]}
riltkprsmtvyegesarfscdtdgepvptvtwlrkgqvlstsarhqvtttkykstfeis
svqasdegnysvvvensegkqeaeftltiqk

Timeline for d1tnna_:

• d1tnna_ first appeared (with stable ids) in SCOP 1.55, called d1tnn__
  
• d1tnna_ appears in SCOPe 2.07