Lineage for d3tyzb_ (3tyz B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1575887Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 1575888Family c.1.21.1: Dihydropteroate synthetase [51718] (2 proteins)
  6. 1575966Protein automated matches [194480] (3 species)
    not a true protein
  7. 1575973Species Yersinia pestis [TaxId:632] [195817] (4 PDB entries)
  8. 1575975Domain d3tyzb_: 3tyz B: [217105]
    automated match to d3tzfb_
    complexed with mg, pab, pop, xhp

Details for d3tyzb_

PDB Entry: 3tyz (more details), 2.07 Å

PDB Description: Crystal Structure of the Yersinia pestis Dihydropteroate synthetase with substrate transition state complex.
PDB Compounds: (B:) 7,8-dihydropteroate synthase

SCOPe Domain Sequences for d3tyzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tyzb_ c.1.21.1 (B:) automated matches {Yersinia pestis [TaxId: 632]}
mhltargltldlsrpqvmgilnvtpdsfsdggchnnldqalqhaqrmlsagatlidigge
strpgaaevseqeeldrvvpvvealaqrfdvwlsvdtskaavitesahagahlindirsl
qepgaleaaaktglpvclmhmqgqpknmqhspyyddlmtdinrffqhhiercvaagiakn
kllldpgfgfgknlahnyqllahlselhhfelpllvgmsrksmvgqllnvppqqrvigsv
acaviaamqgaqiirvhdvketveamciveatrsak

SCOPe Domain Coordinates for d3tyzb_:

Click to download the PDB-style file with coordinates for d3tyzb_.
(The format of our PDB-style files is described here.)

Timeline for d3tyzb_: