SCOPe 2.03: Domain d3tyzb_: 3tyz B:

Lineage for d3tyzb_ (3tyz B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families)

5. Family c.1.21.1: Dihydropteroate synthetase [51718] (2 proteins)

6. Protein automated matches [194480] (3 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [195817] (4 PDB entries)

8. Domain d3tyzb_: 3tyz B: [217105]
   automated match to d3tzfb_
   complexed with mg, pab, pop, xhp

Details for d3tyzb_

PDB Entry: 3tyz, 2.07 Å

PDB Description: Crystal Structure of the Yersinia pestis Dihydropteroate synthetase with substrate transition state complex.

PDB Compounds: (B:) 7,8-dihydropteroate synthase

SCOPe Domain Sequences for d3tyzb_:

Sequence; same for both SEQRES and ATOM records:

>d3tyzb_ c.1.21.1 (B:) automated matches {Yersinia pestis [TaxId: 632]}
mhltargltldlsrpqvmgilnvtpdsfsdggchnnldqalqhaqrmlsagatlidigge
strpgaaevseqeeldrvvpvvealaqrfdvwlsvdtskaavitesahagahlindirsl
qepgaleaaaktglpvclmhmqgqpknmqhspyyddlmtdinrffqhhiercvaagiakn
kllldpgfgfgknlahnyqllahlselhhfelpllvgmsrksmvgqllnvppqqrvigsv
acaviaamqgaqiirvhdvketveamciveatrsak

Timeline for d3tyzb_:

• d3tyzb_ is new in SCOPe 2.03-stable
  
• d3tyzb_ appears in SCOPe 2.04
  
• d3tyzb_ appears in the current release, SCOPe 2.08