Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) |
Family c.1.21.1: Dihydropteroate synthetase [51718] (2 proteins) |
Protein automated matches [194480] (3 species) not a true protein |
Species Yersinia pestis [TaxId:632] [195817] (4 PDB entries) |
Domain d3tyzb_: 3tyz B: [217105] automated match to d3tzfb_ complexed with mg, pab, pop, xhp |
PDB Entry: 3tyz (more details), 2.07 Å
SCOPe Domain Sequences for d3tyzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tyzb_ c.1.21.1 (B:) automated matches {Yersinia pestis [TaxId: 632]} mhltargltldlsrpqvmgilnvtpdsfsdggchnnldqalqhaqrmlsagatlidigge strpgaaevseqeeldrvvpvvealaqrfdvwlsvdtskaavitesahagahlindirsl qepgaleaaaktglpvclmhmqgqpknmqhspyyddlmtdinrffqhhiercvaagiakn kllldpgfgfgknlahnyqllahlselhhfelpllvgmsrksmvgqllnvppqqrvigsv acaviaamqgaqiirvhdvketveamciveatrsak
Timeline for d3tyzb_: