Lineage for d3tyua_ (3tyu A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089689Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 2089690Family c.1.21.1: Dihydropteroate synthetase [51718] (2 protein domains)
  6. 2089772Protein automated matches [194480] (6 species)
    not a true protein
  7. 2089779Species Yersinia pestis [TaxId:632] [195817] (4 PDB entries)
  8. 2089786Domain d3tyua_: 3tyu A: [217102]
    Other proteins in same PDB: d3tyub2
    automated match to d3tzfb_
    complexed with pt1

Details for d3tyua_

PDB Entry: 3tyu (more details), 2.7 Å

PDB Description: crystal structure of dihydropteroate synthetase with product1
PDB Compounds: (A:) 7,8-dihydropteroate synthase

SCOPe Domain Sequences for d3tyua_:

Sequence, based on SEQRES records: (download)

>d3tyua_ c.1.21.1 (A:) automated matches {Yersinia pestis [TaxId: 632]}
mhltargltldlsrpqvmgilnvtpdsfsdggchnnldqalqhaqrmlsagatlidigge
strpgaaevseqeeldrvvpvvealaqrfdvwlsvdtskaavitesahagahlindirsl
qepgaleaaaktglpvclmhmqgqpknmqhspyyddlmtdinrffqhhiercvaagiakn
kllldpgfgfgknlahnyqllahlselhhfelpllvgmsrksmvgqllnvppqqrvigsv
acaviaamqgaqiirvhdvketveamciveatrsa

Sequence, based on observed residues (ATOM records): (download)

>d3tyua_ c.1.21.1 (A:) automated matches {Yersinia pestis [TaxId: 632]}
mhltargltldlsrpqvmgilnvtpdshnnldqalqhaqrmlsagatlidiggestrpga
aevseqeeldrvvpvvealaqrfdvwlsvdtskaavitesahagahlindirslqepgal
eaaaktglpvclmhmqgmqhspyyddlmtdinrffqhhiercvaagiaknkllldpgfgf
gknlahnyqllahlselhhfelpllvgmsrksmvgqllnvppqqrvigsvacaviaamqg
aqiirvhdvketveamciveatrsa

SCOPe Domain Coordinates for d3tyua_:

Click to download the PDB-style file with coordinates for d3tyua_.
(The format of our PDB-style files is described here.)

Timeline for d3tyua_: