Lineage for d1tnm__ (1tnm -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.4: I set domains [49159] (22 proteins) 
Protein Titin [49172] (1 species) Species Human (Homo sapiens), module M5 [TaxId:9606] [49173] (4 PDB entries) 
Domain d1tnm__: 1tnm - [21710]
Details for d1tnm__
PDB Entry: 1tnm (more details)
PDB Description: tertiary structure of an immunoglobulin-like domain from the giant muscle protein titin: a new member of the i set
SCOP Domain Sequences for d1tnm__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tnm__ b.1.1.4 (-) Titin {Human (Homo sapiens), module M5}
riltkprsmtvyegesarfscdtdgepvptvtwlrkgqvlstsarhqvtttkykstfeis
svqasdegnysvvvensegkqeaeftltiqk
SCOP Domain Coordinates for d1tnm__:
Click to download the PDB-style file with coordinates for d1tnm__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tnm__:
- d1tnm__ first appeared (with stable ids) in SCOP 1.55
- d1tnm__ appears in SCOP 1.59
- d1tnm__ appears in the current release, SCOPe 2.08, called d1tnma_
View in 3D