SCOPe 2.04: Domain d3tyfd1: 3tyf D:3-118

Lineage for d3tyfd1 (3tyf D:3-118)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [224856] (1 PDB entry)

8. Domain d3tyfd1: 3tyf D:3-118 [217092]
   Other proteins in same PDB: d3tyfa2, d3tyfb2, d3tyfc2, d3tyfd2
   automated match to d1ktke1
   complexed with gol

Details for d3tyfd1

PDB Entry: 3tyf, 2.81 Å

PDB Description: Crystal structure of a CD1d-lysophosphatidylcholine reactive iNKT TCR

PDB Compounds: (D:) iNKT Cell Receptor Beta Chain

SCOPe Domain Sequences for d3tyfd1:

Sequence, based on SEQRES records:

>d3tyfd1 b.1.1.0 (D:3-118) automated matches {Escherichia coli [TaxId: 562]}
diyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekgdlss
estvsrirtehfpltlesarpshtsqylcasseegalkesvgtqyfgpgtrllvle

Sequence, based on observed residues (ATOM records):

>d3tyfd1 b.1.1.0 (D:3-118) automated matches {Escherichia coli [TaxId: 562]}
diyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekglsse
stvsrirtehfpltlesarpshtsqylcasseegalkegtqyfgpgtrllvle

Timeline for d3tyfd1:

• d3tyfd1 first appeared in SCOPe 2.03
  
• d3tyfd1 appears in SCOPe 2.05
  
• d3tyfd1 appears in the current release, SCOPe 2.08