Lineage for d3tyfd1 (3tyf D:3-118)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754248Species Escherichia coli [TaxId:562] [224856] (3 PDB entries)
  8. 2754252Domain d3tyfd1: 3tyf D:3-118 [217092]
    Other proteins in same PDB: d3tyfa2, d3tyfb2, d3tyfc2, d3tyfd2
    automated match to d1ktke1
    complexed with gol

Details for d3tyfd1

PDB Entry: 3tyf (more details), 2.81 Å

PDB Description: Crystal structure of a CD1d-lysophosphatidylcholine reactive iNKT TCR
PDB Compounds: (D:) iNKT Cell Receptor Beta Chain

SCOPe Domain Sequences for d3tyfd1:

Sequence, based on SEQRES records: (download)

>d3tyfd1 b.1.1.0 (D:3-118) automated matches {Escherichia coli [TaxId: 562]}
diyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekgdlss
estvsrirtehfpltlesarpshtsqylcasseegalkesvgtqyfgpgtrllvle

Sequence, based on observed residues (ATOM records): (download)

>d3tyfd1 b.1.1.0 (D:3-118) automated matches {Escherichia coli [TaxId: 562]}
diyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekglsse
stvsrirtehfpltlesarpshtsqylcasseegalkegtqyfgpgtrllvle

SCOPe Domain Coordinates for d3tyfd1:

Click to download the PDB-style file with coordinates for d3tyfd1.
(The format of our PDB-style files is described here.)

Timeline for d3tyfd1: