Lineage for d3tyfc1 (3tyf C:1-114)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1764958Species Escherichia coli [TaxId:562] [224856] (1 PDB entry)
  8. 1764961Domain d3tyfc1: 3tyf C:1-114 [217090]
    Other proteins in same PDB: d3tyfa2, d3tyfb2, d3tyfc2, d3tyfd2
    automated match to d1qrnd1
    complexed with gol

Details for d3tyfc1

PDB Entry: 3tyf (more details), 2.81 Å

PDB Description: Crystal structure of a CD1d-lysophosphatidylcholine reactive iNKT TCR
PDB Compounds: (C:) iNKT Cell Receptor Alpha Chain

SCOPe Domain Sequences for d3tyfc1:

Sequence, based on SEQRES records: (download)

>d3tyfc1 b.1.1.0 (C:1-114) automated matches {Escherichia coli [TaxId: 562]}
nqveqspqsliilegknctlqcnytvspfsnlrwykqdtgrgpvsltimtfsentksngr
ytatldadtkqsslhitasqlsdsasyicvvsdrgstlgrlyfgrgtqltvwpd

Sequence, based on observed residues (ATOM records): (download)

>d3tyfc1 b.1.1.0 (C:1-114) automated matches {Escherichia coli [TaxId: 562]}
nqveqspqsliilegknctlqcnytvspfsnlrwykqdtgrgpvsltimtfsentksngr
ytatldadtkqsslhitasqlsdsasyicvvsdrgslgrlyfgrgtqltvwpd

SCOPe Domain Coordinates for d3tyfc1:

Click to download the PDB-style file with coordinates for d3tyfc1.
(The format of our PDB-style files is described here.)

Timeline for d3tyfc1: