| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.4: I set domains [49159] (39 proteins) |
| Protein Titin [49172] (1 species) |
| Species Human (Homo sapiens), different modules [TaxId:9606] [49173] (8 PDB entries) |
| Domain d1ncua1: 1ncu A:-5-91 [21709] Other proteins in same PDB: d1ncua2 module M5 |
PDB Entry: 1ncu (more details)
SCOPe Domain Sequences for d1ncua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ncua1 b.1.1.4 (A:-5-91) Titin {Human (Homo sapiens), different modules [TaxId: 9606]}
kttlaariltkprsmtvyegesarfscdtdgepvptvtwlrkgqvlstsarhqvtttkyk
stfeissvqasdegnysvvvensegkqeaeftltiqk
Timeline for d1ncua1: