![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [224856] (3 PDB entries) |
![]() | Domain d3tyfb1: 3tyf B:3-118 [217088] Other proteins in same PDB: d3tyfa2, d3tyfb2, d3tyfc2, d3tyfd2 automated match to d1ktke1 complexed with gol |
PDB Entry: 3tyf (more details), 2.81 Å
SCOPe Domain Sequences for d3tyfb1:
Sequence, based on SEQRES records: (download)
>d3tyfb1 b.1.1.0 (B:3-118) automated matches {Escherichia coli [TaxId: 562]} diyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekgdlss estvsrirtehfpltlesarpshtsqylcasseegalkesvgtqyfgpgtrllvle
>d3tyfb1 b.1.1.0 (B:3-118) automated matches {Escherichia coli [TaxId: 562]} diyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstkgdlses tvsrirtehfpltlesarpshtsqylcasseegalvgtqyfgpgtrllvle
Timeline for d3tyfb1: