Lineage for d3tyfa2 (3tyf A:115-202)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749877Species Escherichia coli [TaxId:562] [224854] (1 PDB entry)
  8. 2749878Domain d3tyfa2: 3tyf A:115-202 [217087]
    Other proteins in same PDB: d3tyfa1, d3tyfb1, d3tyfc1, d3tyfd1
    automated match to d1qrnd2
    complexed with gol

Details for d3tyfa2

PDB Entry: 3tyf (more details), 2.81 Å

PDB Description: Crystal structure of a CD1d-lysophosphatidylcholine reactive iNKT TCR
PDB Compounds: (A:) iNKT Cell Receptor Alpha Chain

SCOPe Domain Sequences for d3tyfa2:

Sequence, based on SEQRES records: (download)

>d3tyfa2 b.1.1.2 (A:115-202) automated matches {Escherichia coli [TaxId: 562]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

Sequence, based on observed residues (ATOM records): (download)

>d3tyfa2 b.1.1.2 (A:115-202) automated matches {Escherichia coli [TaxId: 562]}
iqnpdpavyqlrdsksksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsav
awsnkdfacanafnnsiipedtffp

SCOPe Domain Coordinates for d3tyfa2:

Click to download the PDB-style file with coordinates for d3tyfa2.
(The format of our PDB-style files is described here.)

Timeline for d3tyfa2: