Lineage for d3tyfa1 (3tyf A:1-114)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365537Species Escherichia coli [TaxId:562] [224856] (2 PDB entries)
  8. 2365538Domain d3tyfa1: 3tyf A:1-114 [217086]
    Other proteins in same PDB: d3tyfa2, d3tyfb2, d3tyfc2, d3tyfd2
    automated match to d1qrnd1
    complexed with gol

Details for d3tyfa1

PDB Entry: 3tyf (more details), 2.81 Å

PDB Description: Crystal structure of a CD1d-lysophosphatidylcholine reactive iNKT TCR
PDB Compounds: (A:) iNKT Cell Receptor Alpha Chain

SCOPe Domain Sequences for d3tyfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tyfa1 b.1.1.0 (A:1-114) automated matches {Escherichia coli [TaxId: 562]}
nqveqspqsliilegknctlqcnytvspfsnlrwykqdtgrgpvsltimtfsentksngr
ytatldadtkqsslhitasqlsdsasyicvvsdrgstlgrlyfgrgtqltvwpd

SCOPe Domain Coordinates for d3tyfa1:

Click to download the PDB-style file with coordinates for d3tyfa1.
(The format of our PDB-style files is described here.)

Timeline for d3tyfa1: