| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Escherichia coli [TaxId:562] [224856] (3 PDB entries) |
| Domain d3tyfa1: 3tyf A:1-114 [217086] Other proteins in same PDB: d3tyfa2, d3tyfb2, d3tyfc2, d3tyfd2 automated match to d1qrnd1 complexed with gol |
PDB Entry: 3tyf (more details), 2.81 Å
SCOPe Domain Sequences for d3tyfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tyfa1 b.1.1.0 (A:1-114) automated matches {Escherichia coli [TaxId: 562]}
nqveqspqsliilegknctlqcnytvspfsnlrwykqdtgrgpvsltimtfsentksngr
ytatldadtkqsslhitasqlsdsasyicvvsdrgstlgrlyfgrgtqltvwpd
Timeline for d3tyfa1: