Lineage for d1ncta1 (1nct A:-5-91)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753922Protein Titin [49172] (1 species)
  7. 2753923Species Human (Homo sapiens), different modules [TaxId:9606] [49173] (8 PDB entries)
  8. 2753934Domain d1ncta1: 1nct A:-5-91 [21708]
    Other proteins in same PDB: d1ncta2
    module M5

Details for d1ncta1

PDB Entry: 1nct (more details)

PDB Description: titin module m5, n-terminally extended, nmr
PDB Compounds: (A:) titin

SCOPe Domain Sequences for d1ncta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ncta1 b.1.1.4 (A:-5-91) Titin {Human (Homo sapiens), different modules [TaxId: 9606]}
kttlaariltkprsmtvyegesarfscdtdgepvptvtwlrkgqvlstsarhqvtttkyk
stfeissvqasdegnysvvvensegkqeaeftltiqk

SCOPe Domain Coordinates for d1ncta1:

Click to download the PDB-style file with coordinates for d1ncta1.
(The format of our PDB-style files is described here.)

Timeline for d1ncta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ncta2