Lineage for d3ty7b1 (3ty7 B:1-475)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2141661Species Staphylococcus aureus [TaxId:158878] [226235] (1 PDB entry)
  8. 2141663Domain d3ty7b1: 3ty7 B:1-475 [217075]
    Other proteins in same PDB: d3ty7a2, d3ty7b2
    automated match to d1o9ja_
    complexed with gol, mg, peg

Details for d3ty7b1

PDB Entry: 3ty7 (more details), 2.4 Å

PDB Description: Crystal Structure of Aldehyde Dehydrogenase family Protein from Staphylococcus aureus
PDB Compounds: (B:) Putative aldehyde dehydrogenase SAV2122

SCOPe Domain Sequences for d3ty7b1:

Sequence, based on SEQRES records: (download)

>d3ty7b1 c.82.1.0 (B:1-475) automated matches {Staphylococcus aureus [TaxId: 158878]}
mrdytkqyingewvesnsnetievinpateevigkvakgnkadvdkaveaaddvylefrh
tsvkerqalldkivkeyenrkddivqaitdelgaplslservhyqmglnhfvaardaldn
yefeerrgddlvvkeaigvsglitpwnfptnqtslklaaafaagspvvlkpseetpfaav
ilaeifdkvgvpkgvfnlvngdgagvgnplsehpkvrmmsftgsgptgskimekaakdfk
kvslelggkspyivlddvdikeaakattgkvvnntgqvctagtrvlvpnkikdaflaelk
eqfsqvrvgnpredgtqvgpiiskkqfdqvqnyinkgieegaelfyggpgkpeglekgyf
arptifinvdnqmtiaqeeifgpvmsvityndldeaiqiandtkyglagyvigkdketlh
kvarsieagtveineagrkpdlpfggykqsglgrewgdygieeflevksiagyfk

Sequence, based on observed residues (ATOM records): (download)

>d3ty7b1 c.82.1.0 (B:1-475) automated matches {Staphylococcus aureus [TaxId: 158878]}
mrdytkqyingewvesnsnetievinpateevigkvakgnkadvdkaveaaddvylefrh
tsvkerqalldkivkeyenrkddivqaitdelgaplslservhyqmglnhfvaardaldn
yefeerrgddlvvkeaigvsglitpwnfptnqtslklaaafaagspvvlkpseetpfaav
ilaeifdkvgvpkgvfnlvngdgagvgnplsehpkvrmmsftgsgptgskimekaakdfk
kvslelggkspyivlddvdikeaakattgkvvnntgqvctagtrvlvpnkikdaflaelk
eqfsqvrvgnpredgtqvgpiiskkqfdqvqnyinkgieegaelfyggpgkpeglekgyf
arptifinvdnqmtiaqeeifgpvmsvityndldeaiqiandtkyglagyvigkdketlh
kvarsieagtveineaggieeflevksiagyfk

SCOPe Domain Coordinates for d3ty7b1:

Click to download the PDB-style file with coordinates for d3ty7b1.
(The format of our PDB-style files is described here.)

Timeline for d3ty7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ty7b2