Lineage for d1tlka_ (1tlk A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 787055Family b.1.1.4: I set domains [49159] (38 proteins)
  6. 787384Protein Telokin [49170] (2 species)
  7. 787387Species Turkey (Meleagris gallopavo) [TaxId:9103] [49171] (2 PDB entries)
  8. 787389Domain d1tlka_: 1tlk A: [21707]

Details for d1tlka_

PDB Entry: 1tlk (more details), 2.8 Å

PDB Description: x-ray structure determination of telokin, the c-terminal domain of myosin light chain kinase, at 2.8 angstroms resolution
PDB Compounds: (A:) telokin

SCOP Domain Sequences for d1tlka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tlka_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]}
vaeekphvkpyftktildmdvvegsaarfdckvegypdpevmwfkddnpvkesrhfqidy
deegncsltisevcgdddakytckavnslgeatctaellvetm

SCOP Domain Coordinates for d1tlka_:

Click to download the PDB-style file with coordinates for d1tlka_.
(The format of our PDB-style files is described here.)

Timeline for d1tlka_: