Lineage for d1tlk__ (1tlk -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.4: I set domains [49159] (22 proteins) 
Protein Telokin [49170] (1 species) Species Turkey (Meleagris gallopavo) [TaxId:9103] [49171] (2 PDB entries) 
Domain d1tlk__: 1tlk - [21707]
Details for d1tlk__
PDB Entry: 1tlk (more details), 2.8 Å
PDB Description: x-ray structure determination of telokin, the c-terminal domain of myosin light chain kinase, at 2.8 angstroms resolution
SCOP Domain Sequences for d1tlk__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tlk__ b.1.1.4 (-) Telokin {Turkey (Meleagris gallopavo)}
vaeekphvkpyftktildmdvvegsaarfdckvegypdpevmwfkddnpvkesrhfqidy
deegncsltisevcgdddakytckavnslgeatctaellvetm
SCOP Domain Coordinates for d1tlk__:
Click to download the PDB-style file with coordinates for d1tlk__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tlk__:
- d1tlk__ first appeared (with stable ids) in SCOP 1.55
- d1tlk__ appears in SCOP 1.59
- d1tlk__ appears in the current release, SCOPe 2.08, called d1tlka_
View in 3D