Lineage for d1tlk__ (1tlk -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9408Family b.1.1.4: I set domains [49159] (21 proteins)
  6. 9550Protein Telokin [49170] (1 species)
  7. 9551Species Turkey (Meleagris gallopavo) [TaxId:9103] [49171] (2 PDB entries)
  8. 9553Domain d1tlk__: 1tlk - [21707]

Details for d1tlk__

PDB Entry: 1tlk (more details), 2.8 Å

PDB Description: x-ray structure determination of telokin, the c-terminal domain of myosin light chain kinase, at 2.8 angstroms resolution

SCOP Domain Sequences for d1tlk__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tlk__ b.1.1.4 (-) Telokin {Turkey (Meleagris gallopavo)}
vaeekphvkpyftktildmdvvegsaarfdckvegypdpevmwfkddnpvkesrhfqidy
deegncsltisevcgdddakytckavnslgeatctaellvetm

SCOP Domain Coordinates for d1tlk__:

Click to download the PDB-style file with coordinates for d1tlk__.
(The format of our PDB-style files is described here.)

Timeline for d1tlk__: