SCOPe 2.08: Domain d1tlka_: 1tlk A:

Lineage for d1tlka_ (1tlk A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Telokin [49170] (2 species)

7. Species Turkey (Meleagris gallopavo) [TaxId:9103] [49171] (2 PDB entries)

8. Domain d1tlka_: 1tlk A: [21707]

Details for d1tlka_

PDB Entry: 1tlk, 2.8 Å

PDB Description: x-ray structure determination of telokin, the c-terminal domain of myosin light chain kinase, at 2.8 angstroms resolution

PDB Compounds: (A:) telokin

SCOPe Domain Sequences for d1tlka_:

Sequence; same for both SEQRES and ATOM records:

>d1tlka_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]}
vaeekphvkpyftktildmdvvegsaarfdckvegypdpevmwfkddnpvkesrhfqidy
deegncsltisevcgdddakytckavnslgeatctaellvetm

Timeline for d1tlka_:

• d1tlka_ first appeared (with stable ids) in SCOP 1.55, called d1tlk__
  
• d1tlka_ appears in SCOPe 2.07