Lineage for d1fhga_ (1fhg A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2364875Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2365228Protein Telokin [49170] (2 species)
  7. 2365231Species Turkey (Meleagris gallopavo) [TaxId:9103] [49171] (2 PDB entries)
  8. 2365232Domain d1fhga_: 1fhg A: [21706]

Details for d1fhga_

PDB Entry: 1fhg (more details), 2 Å

PDB Description: high resolution refinement of telokin
PDB Compounds: (A:) telokin

SCOPe Domain Sequences for d1fhga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]}
aeekphvkpyftktildmevvegsaarfdckvegypdpevmwfkddnpvkesrhfqidyd
eegncsltisevcgdddakytckavnslgeatctaellvetm

SCOPe Domain Coordinates for d1fhga_:

Click to download the PDB-style file with coordinates for d1fhga_.
(The format of our PDB-style files is described here.)

Timeline for d1fhga_: