Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Telokin [49170] (2 species) |
Species Turkey (Meleagris gallopavo) [TaxId:9103] [49171] (2 PDB entries) |
Domain d1fhga_: 1fhg A: [21706] |
PDB Entry: 1fhg (more details), 2 Å
SCOPe Domain Sequences for d1fhga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} aeekphvkpyftktildmevvegsaarfdckvegypdpevmwfkddnpvkesrhfqidyd eegncsltisevcgdddakytckavnslgeatctaellvetm
Timeline for d1fhga_: