Lineage for d1fhga_ (1fhg A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54281Family b.1.1.4: I set domains [49159] (22 proteins)
  6. 54477Protein Telokin [49170] (1 species)
  7. 54478Species Turkey (Meleagris gallopavo) [TaxId:9103] [49171] (2 PDB entries)
  8. 54479Domain d1fhga_: 1fhg A: [21706]

Details for d1fhga_

PDB Entry: 1fhg (more details), 2 Å

PDB Description: high resolution refinement of telokin

SCOP Domain Sequences for d1fhga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo)}
aeekphvkpyftktildmevvegsaarfdckvegypdpevmwfkddnpvkesrhfqidyd
eegncsltisevcgdddakytckavnslgeatctaellvetm

SCOP Domain Coordinates for d1fhga_:

Click to download the PDB-style file with coordinates for d1fhga_.
(The format of our PDB-style files is described here.)

Timeline for d1fhga_: