Lineage for d3tvwa2 (3tvw A:1815-2195)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2099797Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (7 protein domains)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 2099959Protein automated matches [226926] (3 species)
    not a true protein
  7. 2099999Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [226234] (6 PDB entries)
  8. 2100019Domain d3tvwa2: 3tvw A:1815-2195 [217054]
    automated match to d1od2a2
    complexed with 07h

Details for d3tvwa2

PDB Entry: 3tvw (more details), 2.8 Å

PDB Description: Crystal Structure of the humanized carboxyltransferase domain of yeast Acetyl-coA caroxylase in complex with compound 4
PDB Compounds: (A:) acetyl-coa carboxylase

SCOPe Domain Sequences for d3tvwa2:

Sequence, based on SEQRES records: (download)

>d3tvwa2 c.14.1.4 (A:1815-2195) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
nmpvpiletkdtwdrpvdftptndetydvrwmiegretesgfeyglfdkgsffetlsgwa
kgvvvgrarlggiplgvigvetrtvenlipadpanpnsaetliqqagqvwfpnsafktaq
aindfnngeqlpmmilanwrgfsggqrdmfnevlkygsfivdalvdykqpiiiyipptge
lrggswvvvdptinadqmemyadvnaragvlepegtveikfrreklldtmnrlddkyrel
rsqlsnkslapevhqqiskqladrerellpiygqislqfadlhdrssrmvakgviskele
wtearrfffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqvatw
ieenyktlddklkglklesfa

Sequence, based on observed residues (ATOM records): (download)

>d3tvwa2 c.14.1.4 (A:1815-2195) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
nmpvpiletkdtwdrpvdftptndetydvrwmiegretesgfeyglfdkgsffetlsgwa
kgvvvgrarlggiplgvigvetrtvenlipadpanpnsaetliqqagqvwfpnsafktaq
aindfnngeqlpmmilanwrgfsggqrdmfnevlkygsfivdalvdykqpiiiyipptge
lrggswvvvdptinadqmemyadvnaragvlepegtveikfrreklldtmnrlddkyrel
rsqlapevhqqiskqladrerellpiygqislqfadlhdrssrmvakgviskelewtear
rfffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqvatwieeny
ktlddklkglklesfa

SCOPe Domain Coordinates for d3tvwa2:

Click to download the PDB-style file with coordinates for d3tvwa2.
(The format of our PDB-style files is described here.)

Timeline for d3tvwa2: