SCOPe 2.07: Domain d1bqsa2: 1bqs A:91-209

Lineage for d1bqsa2 (1bqs A:91-209)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Mucosal addressin cell adhesion molecule-1 (MADCAM-1) [49168] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49169] (2 PDB entries)

8. Domain d1bqsa2: 1bqs A:91-209 [21705]
   complexed with ndg

Details for d1bqsa2

PDB Entry: 1bqs, 2.2 Å

PDB Description: the crystal structure of mucosal addressin cell adhesion molecule-1 (madcam-1)

PDB Compounds: (A:) protein (mucosal addressin cell adhesion molecule-1)

SCOPe Domain Sequences for d1bqsa2:

Sequence; same for both SEQRES and ATOM records:

>d1bqsa2 b.1.1.4 (A:91-209) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]}
afpnqltvspaalvpgdpevactahkvtpvdpnalsfsllvggqelegaqalgpevqeee
eepqgdedvlfrvterwrlpplgtpvppalycqatmrlpglelshrqaipvlhsptspe

Timeline for d1bqsa2:

• d1bqsa2 first appeared (with stable ids) in SCOP 1.55
  
• d1bqsa2 appears in SCOPe 2.06
  
• d1bqsa2 appears in the current release, SCOPe 2.08