Lineage for d1bqsa2 (1bqs A:91-209)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.4: I set domains [49159] (21 proteins) 
Protein Mucosal addressin cell adhesion molecule-1 (MADCAM-1) [49168] (1 species) Species Human (Homo sapiens) [TaxId:9606] [49169] (1 PDB entry) 
Domain d1bqsa2: 1bqs A:91-209 [21705]
Details for d1bqsa2
PDB Entry: 1bqs (more details), 2.2 Å
PDB Description: the crystal structure of mucosal addressin cell adhesion molecule-1 (madcam-1)
SCOP Domain Sequences for d1bqsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bqsa2 b.1.1.4 (A:91-209) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens)}
afpnqltvspaalvpgdpevactahkvtpvdpnalsfsllvggqelegaqalgpevqeee
eepqgdedvlfrvterwrlpplgtpvppalycqatmrlpglelshrqaipvlhsptspe
SCOP Domain Coordinates for d1bqsa2:
Click to download the PDB-style file with coordinates for d1bqsa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bqsa2:
- d1bqsa2 appears in SCOP 1.57
- d1bqsa2 appears in the current release, SCOPe 2.08
View in 3D
