![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (9 proteins) Pfam PF01039 the active site is formed by two different homologous subunits or domains of this fold |
![]() | Protein automated matches [226926] (3 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [226234] (6 PDB entries) |
![]() | Domain d3tvua1: 3tvu A:1480-1814 [217047] automated match to d1uyrb1 complexed with b37 |
PDB Entry: 3tvu (more details), 2.4 Å
SCOPe Domain Sequences for d3tvua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tvua1 c.14.1.4 (A:1480-1814) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} lrpiatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffis neliedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpq edeffnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylylt segmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsray hdiftitlvtcrsvgigaylvrlgqraiqvegqpiiltgasalnkvlgrevytsnlqlgg tqimynngvshltavddlagvekivewmsyvpakr
Timeline for d3tvua1:
![]() Domains from other chains: (mouse over for more information) d3tvub1, d3tvub2, d3tvuc1, d3tvuc2 |