SCOPe 2.07: Domain d3tvua1: 3tvu A:1480-1814

Lineage for d3tvua1 (3tvu A:1480-1814)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (7 protein domains)
   Pfam PF01039
   the active site is formed by two different homologous subunits or domains of this fold

6. Protein automated matches [226926] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [226234] (6 PDB entries)

8. Domain d3tvua1: 3tvu A:1480-1814 [217047]
   automated match to d1uyrb1
   complexed with b37

Details for d3tvua1

PDB Entry: 3tvu, 2.4 Å

PDB Description: crystal structure of the humanized carboxyltransferase domain of yeast acetyl-coa caroxylase in complex with compound 3

PDB Compounds: (A:) acetyl-coa carboxylase

SCOPe Domain Sequences for d3tvua1:

Sequence; same for both SEQRES and ATOM records:

>d3tvua1 c.14.1.4 (A:1480-1814) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
lrpiatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffis
neliedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpq
edeffnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylylt
segmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsray
hdiftitlvtcrsvgigaylvrlgqraiqvegqpiiltgasalnkvlgrevytsnlqlgg
tqimynngvshltavddlagvekivewmsyvpakr

Timeline for d3tvua1:

• d3tvua1 first appeared in SCOPe 2.03
  
• d3tvua1 appears in SCOPe 2.06