Lineage for d3tvra_ (3tvr A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1431002Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1431243Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1431528Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 1431529Protein automated matches [190218] (13 species)
    not a true protein
  7. 1431631Species Streptomyces coelicolor [TaxId:1902] [195657] (2 PDB entries)
  8. 1431632Domain d3tvra_: 3tvr A: [217046]
    automated match to d3tl1b_
    complexed with gol

Details for d3tvra_

PDB Entry: 3tvr (more details), 1.8 Å

PDB Description: crystal structure of streptomyces coelicolor polyketide aromatase/cyclase whie-orfvi
PDB Compounds: (A:) Polyketide cyclase

SCOPe Domain Sequences for d3tvra_:

Sequence, based on SEQRES records: (download)

>d3tvra_ d.129.3.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
hhhhssglvprgshmaghtdneitiaapmelvwnmtndiekwpglfseyasvevlgrddd
kvtfrltmhpdadgkvwswvservadpvtrtvraqrvetgpfqymnivweyaetaegtvm
rwtqdfamkpdapvddawmtdninrnsrtqmalirdrieqaagerrtasvlad

Sequence, based on observed residues (ATOM records): (download)

>d3tvra_ d.129.3.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
hhhhssglvprghmaghtdneitiaapmelvwnmtndiekwpglfseyasvevlgrdddk
vtfrltmhpdadgkvwswvservadpvtrtvraqrvetgpfqymnivweyaetaegtvmr
wtqdfamkpdapvddawmtdninrnsrtqmalirdrieqaagerrtasvlad

SCOPe Domain Coordinates for d3tvra_:

Click to download the PDB-style file with coordinates for d3tvra_.
(The format of our PDB-style files is described here.)

Timeline for d3tvra_: