| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
| Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
| Protein automated matches [190218] (21 species) not a true protein |
| Species Streptomyces coelicolor [TaxId:1902] [195657] (2 PDB entries) |
| Domain d3tvra1: 3tvr A:0-159 [217046] Other proteins in same PDB: d3tvra2 automated match to d3tl1b_ complexed with gol |
PDB Entry: 3tvr (more details), 1.8 Å
SCOPe Domain Sequences for d3tvra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tvra1 d.129.3.0 (A:0-159) automated matches {Streptomyces coelicolor [TaxId: 1902]}
hmaghtdneitiaapmelvwnmtndiekwpglfseyasvevlgrdddkvtfrltmhpdad
gkvwswvservadpvtrtvraqrvetgpfqymnivweyaetaegtvmrwtqdfamkpdap
vddawmtdninrnsrtqmalirdrieqaagerrtasvlad
Timeline for d3tvra1: