SCOPe 2.08: Domain d3tvra1: 3tvr A:0-159

Lineage for d3tvra1 (3tvr A:0-159)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (21 species)
   not a true protein

7. Species Streptomyces coelicolor [TaxId:1902] [195657] (2 PDB entries)

8. Domain d3tvra1: 3tvr A:0-159 [217046]
   Other proteins in same PDB: d3tvra2
   automated match to d3tl1b_
   complexed with gol

Details for d3tvra1

PDB Entry: 3tvr, 1.8 Å

PDB Description: crystal structure of streptomyces coelicolor polyketide aromatase/cyclase whie-orfvi

PDB Compounds: (A:) Polyketide cyclase

SCOPe Domain Sequences for d3tvra1:

Sequence; same for both SEQRES and ATOM records:

>d3tvra1 d.129.3.0 (A:0-159) automated matches {Streptomyces coelicolor [TaxId: 1902]}
hmaghtdneitiaapmelvwnmtndiekwpglfseyasvevlgrdddkvtfrltmhpdad
gkvwswvservadpvtrtvraqrvetgpfqymnivweyaetaegtvmrwtqdfamkpdap
vddawmtdninrnsrtqmalirdrieqaagerrtasvlad

Timeline for d3tvra1:

• d3tvra1 first appeared in SCOPe 2.03, called d3tvra_
  
• d3tvra1 appears in SCOPe 2.07