Lineage for d3tv5c2 (3tv5 C:1815-2192)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2099797Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (7 protein domains)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 2099959Protein automated matches [226926] (3 species)
    not a true protein
  7. 2099999Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [226234] (6 PDB entries)
  8. 2100017Domain d3tv5c2: 3tv5 C:1815-2192 [217045]
    automated match to d1od2a2
    complexed with rcp

Details for d3tv5c2

PDB Entry: 3tv5 (more details), 2.8 Å

PDB Description: Crystal Structure of the humanized carboxyltransferase domain of yeast Acetyl-coA caroxylase in complex with compound 1
PDB Compounds: (C:) acetyl-coa carboxylase

SCOPe Domain Sequences for d3tv5c2:

Sequence, based on SEQRES records: (download)

>d3tv5c2 c.14.1.4 (C:1815-2192) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
nmpvpiletkdtwdrpvdftptndetydvrwmiegretesgfeyglfdkgsffetlsgwa
kgvvvgrarlggiplgvigvetrtvenlipadpanpnsaetliqqagqvwfpnsafktaq
aindfnngeqlpmmilanwrgfsggqrdmfnevlkygsfivdalvdykqpiiiyipptge
lrggswvvvdptinadqmemyadvnaragvlepegtveikfrreklldtmnrlddkyrel
rsqlsnkslapevhqqiskqladrerellpiygqislqfadlhdrssrmvakgviskele
wtearrfffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqvatw
ieenyktlddklkglkle

Sequence, based on observed residues (ATOM records): (download)

>d3tv5c2 c.14.1.4 (C:1815-2192) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
nmpvpiletkdtwdrpvdftptndetydvrwmiegretesgfeyglfdkgsffetlsgwa
kgvvvgrarlggiplgvigvetrtvenlipadpanpnsaetliqqagqvwfpnsafktaq
aindfnngeqlpmmilanwrgfsggqrdmfnevlkygsfivdalvdykqpiiiyipptge
lrggswvvvdptinadqmemyadvnaragvlepegtveikfrreklldtmnrlddkyrel
rsqladrerellpiygqislqfadlhdrssrmvakgviskelewtearrfffwrlrrrln
eeylikrlshqvgeasrlekiarirswypasvdheddrqvatwieenyktlddklkglkl
e

SCOPe Domain Coordinates for d3tv5c2:

Click to download the PDB-style file with coordinates for d3tv5c2.
(The format of our PDB-style files is described here.)

Timeline for d3tv5c2: