Lineage for d3tv5b1 (3tv5 B:1480-1814)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853345Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (9 proteins)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 2853512Protein automated matches [226926] (3 species)
    not a true protein
  7. 2853552Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [226234] (6 PDB entries)
  8. 2853559Domain d3tv5b1: 3tv5 B:1480-1814 [217042]
    automated match to d1uyrb1
    complexed with rcp

Details for d3tv5b1

PDB Entry: 3tv5 (more details), 2.8 Å

PDB Description: Crystal Structure of the humanized carboxyltransferase domain of yeast Acetyl-coA caroxylase in complex with compound 1
PDB Compounds: (B:) acetyl-coa carboxylase

SCOPe Domain Sequences for d3tv5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tv5b1 c.14.1.4 (B:1480-1814) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
lrpiatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffis
neliedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpq
edeffnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylylt
segmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsray
hdiftitlvtcrsvgigaylvrlgqraiqvegqpiiltgasalnkvlgrevytsnlqlgg
tqimynngvshltavddlagvekivewmsyvpakr

SCOPe Domain Coordinates for d3tv5b1:

Click to download the PDB-style file with coordinates for d3tv5b1.
(The format of our PDB-style files is described here.)

Timeline for d3tv5b1: