Lineage for d3tv5a1 (3tv5 A:1480-1814)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1353895Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1353896Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1354508Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (7 proteins)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 1354670Protein automated matches [226926] (3 species)
    not a true protein
  7. 1354696Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [226234] (4 PDB entries)
  8. 1354703Domain d3tv5a1: 3tv5 A:1480-1814 [217040]
    automated match to d1uyrb1
    complexed with rcp

Details for d3tv5a1

PDB Entry: 3tv5 (more details), 2.8 Å

PDB Description: Crystal Structure of the humanized carboxyltransferase domain of yeast Acetyl-coA caroxylase in complex with compound 1
PDB Compounds: (A:) acetyl-coa carboxylase

SCOPe Domain Sequences for d3tv5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tv5a1 c.14.1.4 (A:1480-1814) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
lrpiatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffis
neliedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpq
edeffnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylylt
segmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsray
hdiftitlvtcrsvgigaylvrlgqraiqvegqpiiltgasalnkvlgrevytsnlqlgg
tqimynngvshltavddlagvekivewmsyvpakr

SCOPe Domain Coordinates for d3tv5a1:

Click to download the PDB-style file with coordinates for d3tv5a1.
(The format of our PDB-style files is described here.)

Timeline for d3tv5a1: