Lineage for d3tv3l1 (3tv3 L:3-107)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1765214Domain d3tv3l1: 3tv3 L:3-107 [217038]
    Other proteins in same PDB: d3tv3l2
    automated match to d1lgva1
    complexed with aml, epe, gol

Details for d3tv3l1

PDB Entry: 3tv3 (more details), 1.29 Å

PDB Description: crystal structure of broad and potent hiv-1 neutralizing antibody pgt128 in complex with man9
PDB Compounds: (L:) PGT128 light chain, Ig lambda-2 chain C regions

SCOPe Domain Sequences for d3tv3l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tv3l1 b.1.1.0 (L:3-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
altqppsasgspgqsitisctgtsnnfvswyqqhagkapklviydvnkrpsgvpdrfsgs
ksgntasltvsglqtddeavyycgslvgnwdvifgggtkltvlg

SCOPe Domain Coordinates for d3tv3l1:

Click to download the PDB-style file with coordinates for d3tv3l1.
(The format of our PDB-style files is described here.)

Timeline for d3tv3l1: