SCOPe 2.08: Domain d2ncma_: 2ncm A:

Lineage for d2ncma_ (2ncm A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Neural cell adhesion molecule (NCAM) [49166] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [49167] (4 PDB entries)
   Rat and mouse sequences are identical for the two N-terminal modules

8. Domain d2ncma_: 2ncm A: [21703]
   module 1; from mouse protein

Details for d2ncma_

PDB Entry: 2ncm

PDB Description: neural cell adhesion molecule, nmr, 20 structures

PDB Compounds: (A:) neural cell adhesion molecule

SCOPe Domain Sequences for d2ncma_:

Sequence; same for both SEQRES and ATOM records:

>d2ncma_ b.1.1.4 (A:) Neural cell adhesion molecule (NCAM) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rvlqvdivpsqgeisvgeskfflcqvagdakdkdiswfspngeklspnqqrisvvwnddd
sstltiynaniddagiykcvvtaedgtqseatvnvkifq

Timeline for d2ncma_:

• d2ncma_ first appeared (with stable ids) in SCOP 1.55, called d2ncm__
  
• d2ncma_ appears in SCOPe 2.07