Class b: All beta proteins [48724] (180 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.0: automated matches [191644] (1 protein) not a true family |
Protein automated matches [191182] (20 species) not a true protein |
Species Mason-pfizer monkey virus [TaxId:11855] [225168] (16 PDB entries) |
Domain d3ttaa_: 3tta A: [217027] automated match to d1q5hc_ complexed with ump |
PDB Entry: 3tta (more details), 2 Å
SCOPe Domain Sequences for d3ttaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ttaa_ b.85.4.0 (A:) automated matches {Mason-pfizer monkey virus [TaxId: 11855]} qkqpiskltratpgsagldlcstshtvltpemgpqalstgiygplppntfglilgrssit mkglqvypgvidndytgeikimakavnnivtvsqgnriaqlillplietdnkv
Timeline for d3ttaa_: