Lineage for d3ncma_ (3ncm A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9408Family b.1.1.4: I set domains [49159] (21 proteins)
  6. 9519Protein Neural cell adhesion molecule (NCAM) [49166] (1 species)
  7. 9520Species Rat (Rattus norvegicus) [TaxId:10116] [49167] (3 PDB entries)
  8. 9530Domain d3ncma_: 3ncm A: [21702]

Details for d3ncma_

PDB Entry: 3ncm (more details)

PDB Description: neural cell adhesion molecule, module 2, nmr, 20 structures

SCOP Domain Sequences for d3ncma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ncma_ b.1.1.4 (A:) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus)}
yvmfknaptpqefkegedavivcdvvsslpptiiwkhkgrdvilkkdvrfivlsnnylqi
rgikktdegtyrcegrilargeinfkdiqviv

SCOP Domain Coordinates for d3ncma_:

Click to download the PDB-style file with coordinates for d3ncma_.
(The format of our PDB-style files is described here.)

Timeline for d3ncma_: