SCOPe 2.08: Domain d3ncma1: 3ncm A:3-92

Lineage for d3ncma1 (3ncm A:3-92)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Neural cell adhesion molecule (NCAM) [49166] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [49167] (4 PDB entries)
   Rat and mouse sequences are identical for the two N-terminal modules

8. Domain d3ncma1: 3ncm A:3-92 [21702]
   Other proteins in same PDB: d3ncma2
   module 2

Details for d3ncma1

PDB Entry: 3ncm

PDB Description: neural cell adhesion molecule, module 2, nmr, 20 structures

PDB Compounds: (A:) protein (neural cell adhesion molecule, large isoform)

SCOPe Domain Sequences for d3ncma1:

Sequence; same for both SEQRES and ATOM records:

>d3ncma1 b.1.1.4 (A:3-92) Neural cell adhesion molecule (NCAM) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mfknaptpqefkegedavivcdvvsslpptiiwkhkgrdvilkkdvrfivlsnnylqirg
ikktdegtyrcegrilargeinfkdiqviv

Timeline for d3ncma1:

• d3ncma1 first appeared (with stable ids) in SCOP 1.55, called d3ncma_
  
• d3ncma1 appears in SCOPe 2.07