Lineage for d3trhn_ (3trh N:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857183Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) (S)
  5. 2857299Family c.23.8.0: automated matches [191522] (1 protein)
    not a true family
  6. 2857300Protein automated matches [190879] (8 species)
    not a true protein
  7. 2857327Species Coxiella burnetii [TaxId:777] [226223] (1 PDB entry)
  8. 2857341Domain d3trhn_: 3trh N: [217018]
    automated match to d3opqg_

Details for d3trhn_

PDB Entry: 3trh (more details), 2.2 Å

PDB Description: structure of a phosphoribosylaminoimidazole carboxylase catalytic subunit (pure) from coxiella burnetii
PDB Compounds: (N:) Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit

SCOPe Domain Sequences for d3trhn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3trhn_ c.23.8.0 (N:) automated matches {Coxiella burnetii [TaxId: 777]}
kifvailmgsdsdlstmetaftelkslgipfeahilsahrtpketvefvenadnrgcavf
iaaaglaahlagtiaahtlkpvigvpmaggslggldallstvqmpggvpvactaigkaga
knaailaaqiialqdksiaqklvqqrtakretlkkadenlqtql

SCOPe Domain Coordinates for d3trhn_:

Click to download the PDB-style file with coordinates for d3trhn_.
(The format of our PDB-style files is described here.)

Timeline for d3trhn_: