| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) ![]() |
| Family c.23.8.0: automated matches [191522] (1 protein) not a true family |
| Protein automated matches [190879] (8 species) not a true protein |
| Species Coxiella burnetii [TaxId:777] [226223] (1 PDB entry) |
| Domain d3trhi_: 3trh I: [217013] automated match to d3opqg_ |
PDB Entry: 3trh (more details), 2.2 Å
SCOPe Domain Sequences for d3trhi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3trhi_ c.23.8.0 (I:) automated matches {Coxiella burnetii [TaxId: 777]}
nkifvailmgsdsdlstmetaftelkslgipfeahilsahrtpketvefvenadnrgcav
fiaaaglaahlagtiaahtlkpvigvpmaggslggldallstvqmpggvpvactaigkag
aknaailaaqiialqdksiaqklvqqrtakretlkkadenlqtql
Timeline for d3trhi_: