Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families) |
Family d.58.10.0: automated matches [191394] (1 protein) not a true family |
Protein automated matches [190511] (8 species) not a true protein |
Species Coxiella burnetii [TaxId:227377] [226233] (1 PDB entry) |
Domain d3trga_: 3trg A: [217004] automated match to d2w4ca_ complexed with cl, edo |
PDB Entry: 3trg (more details), 1.6 Å
SCOPe Domain Sequences for d3trga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3trga_ d.58.10.0 (A:) automated matches {Coxiella burnetii [TaxId: 227377]} mtqkeknetcihvtvsgkvqgvffresvrkkaeelqltgwvknlshgdvelvacgerdsi miltewlwegppqaavsnvnweeivvedysdfrvr
Timeline for d3trga_: