Lineage for d3trga_ (3trg A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953323Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families) (S)
  5. 2953403Family d.58.10.0: automated matches [191394] (1 protein)
    not a true family
  6. 2953404Protein automated matches [190511] (8 species)
    not a true protein
  7. 2953410Species Coxiella burnetii [TaxId:227377] [226233] (1 PDB entry)
  8. 2953411Domain d3trga_: 3trg A: [217004]
    automated match to d2w4ca_
    complexed with cl, edo

Details for d3trga_

PDB Entry: 3trg (more details), 1.6 Å

PDB Description: structure of an acylphosphatase from coxiella burnetii
PDB Compounds: (A:) acylphosphatase

SCOPe Domain Sequences for d3trga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3trga_ d.58.10.0 (A:) automated matches {Coxiella burnetii [TaxId: 227377]}
mtqkeknetcihvtvsgkvqgvffresvrkkaeelqltgwvknlshgdvelvacgerdsi
miltewlwegppqaavsnvnweeivvedysdfrvr

SCOPe Domain Coordinates for d3trga_:

Click to download the PDB-style file with coordinates for d3trga_.
(The format of our PDB-style files is described here.)

Timeline for d3trga_: