Lineage for d3tqwb1 (3tqw B:2-237)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2522523Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2522524Protein automated matches [190039] (158 species)
    not a true protein
  7. 2522848Species Coxiella burnetii [TaxId:777] [189739] (2 PDB entries)
  8. 2522851Domain d3tqwb1: 3tqw B:2-237 [217003]
    Other proteins in same PDB: d3tqwa2, d3tqwb2
    automated match to d4ef1b_
    complexed with met, so4

Details for d3tqwb1

PDB Entry: 3tqw (more details), 2 Å

PDB Description: structure of a abc transporter, periplasmic substrate-binding protein from coxiella burnetii
PDB Compounds: (B:) Methionine-binding protein

SCOPe Domain Sequences for d3tqwb1:

Sequence, based on SEQRES records: (download)

>d3tqwb1 c.94.1.0 (B:2-237) automated matches {Coxiella burnetii [TaxId: 777]}
vrvgtiagpetqlmevakqvalnryglhvniitfsdyntpnealadgsvdanmfqhlpyl
kaqiemrgykivsigktfvypmglyskkitaltqlktgakiavpsdpsnearalllleka
qliqlkthvtinatpmdiasnpkklkiveldaaqlsrslgdvdlaaintnyaipaglsps
rdalltegpnspyanvvavreddkndprlkqlvsalhspavlsaakkifgdgaipa

Sequence, based on observed residues (ATOM records): (download)

>d3tqwb1 c.94.1.0 (B:2-237) automated matches {Coxiella burnetii [TaxId: 777]}
vrvgtiagpetqlmevakqvalnryglhvniitfsdyntpnealadgsvdanmfqhlpyl
kaqiemrgykivsigktfvypmglyskkitaltqlktgakiavpsdpsnearalllleka
qliqlktnatpmdiasnpkklkiveldaaqlsrslgdvdlaaintnyaipaglspsrdal
ltegpnspyanvvavreddkndprlkqlvsalhspavlsaakkifgdgaipa

SCOPe Domain Coordinates for d3tqwb1:

Click to download the PDB-style file with coordinates for d3tqwb1.
(The format of our PDB-style files is described here.)

Timeline for d3tqwb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tqwb2